PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun007977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 297aa    MW: 32660.1 Da    PI: 7.8609
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-2439PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-181257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+ lG+++W+ I++ ++ gR++k+c++rw + 
        Vun007977 12 KGPWSPEEDEALQRLVQALGPRNWTVISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding56.28.1e-1866108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +v+a+ ++G++ W+tIar ++ gRt++ +k++w++ 
        Vun007977  66 PFTPEEDDAIVRAHSRFGNK-WATIARLLN-GRTDNAVKNHWNST 108
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.185762IPR017930Myb domain
SuperFamilySSF466891.24E-319105IPR009057Homeodomain-like
SMARTSM007171.2E-151160IPR001005SANT/Myb domain
PfamPF002491.2E-171257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-241365IPR009057Homeodomain-like
CDDcd001673.73E-141456No hitNo description
SMARTSM007174.5E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129421.16364113IPR017930Myb domain
CDDcd001671.60E-1166109No hitNo description
PfamPF002495.6E-1566108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2366112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MASGSRDMDR VKGPWSPEED EALQRLVQAL GPRNWTVISK SIPGRSGKSC RLRWCNQLSP  60
EVEHRPFTPE EDDAIVRAHS RFGNKWATIA RLLNGRTDNA VKNHWNSTLK RKCSALDLDD  120
TDRPLLKRSA SVGAGYLNPS SPSGSNLSDP GQPALSTPSA SALCRPNLME TASSLSDPAT  180
SLSLCLPGLS SEPNTVAVQR PASPPPAVPP PVPTVEERGK QLFNXGVLDG DARDDKEGSE  240
ELHVRDGGEE WVENTNGSHW KRGDEAHGNQ QHRVREELKK RCRLESQKEG RPLDMKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C7e-40111133105C-Myb DNA-Binding Domain
1mse_C7e-40111133105C-Myb DNA-Binding Domain
1gv2_A7e-40111133105MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-391111357159MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-391111357159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160886.11e-131hypothetical protein PHAVU_001G025200g
SwissprotQ9FDW19e-73MYB44_ARATH; Transcription factor MYB44
TrEMBLV7CUC31e-131V7CUC3_PHAVU; Uncharacterized protein
STRINGGLYMA17G35620.11e-105(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.18e-69myb domain protein 73